Nebraska Newspapers

    mBBanBBBBBBBBnaa
. - u. . . .. . ' . , ., -. . '-i .-.. M,-mwJktMmjmrSBmmmmmMh - l a'ramis w w : jia u.iA jaMah..,
.. vv v .
'fr V
a . - -i " - " - - . .
-'
4f
,
i4Vt',
m
k
5 "
.p.
jf
f-
I
MvU.MM.
Calumbuslirarttal.
jadge,- ---
8, H. SEDGWICK, York. .
at B, GOOLD, of Ogallaja.
a J.ERNST, of
;er County Jedge,
V .- - W. Mi Ua&HJBTEB:'
--."-: . LEE MARTIN. ;..-
:Fer" eiety Cserk, ."
- CHARLES W.JENS.
QEOBQErBRODFUEHKER.
Fee-
DR. Ir O. WALKER.
H: pi ttODEHORST.
:CITT TICKKT.
-4
ef the Petes; -'
J:M.CUBTI& .
HENRY OOOI4DOE.
-Far
0..fc.'8HNN0N.'
MARVIN ELSTON.
Befalo,
Mew Turk, May 1 to November 1.1W1. .
.''Wwm OasTrsgs AssbwatioB, LiacolB,
"Ejrrxto U wVla wfal waya,'
- Who aire- Hie woiildrhe' third?
"'tgrmers running., far . office, in
tPlcilte .-county?. " -;.;
'-. . iBTBxiuaEscx- alad- iadaptry are, the
Smaaff' , , . a n . ,
-.hajva,: aad every..-man.-can. Jlave
-.4rMatoay..;..o.- .; - '
:ABXBaiK it i. said, has
to.farajah aaeh-chardi in
WwHliainot already provided, with' a
it. -- .-'.-.
B. L.Ooqu has wfthdrawa hi
for.regcat'oa the. atate- re-
tiokaad the committee has
a call-to ilLtbevacaacyl-
i alght on between the beeU
sadT:the' aagar. traat, an
. affsrtref the4U-.to psnkh, the former
taBMtiageegara?iBlaatifal.. -"'
:..Tan U. S.'treaary statement shows
. hslsafiBS ia- the general fahd exclusive
af; the 150j00Ct0gO gold resarvft ia the'
jaiviaisa .of iTsd.amption: available cash
aalaaees, fl 790002; gold, 101,18300.
- Ta dabtasyiag habit m commeada-
'i.hleia' natioiae aa well as iaiadTvidaala.
The .decrease ia the public. debt of the
Uakiat-Stataa dariagthe month of Sep
.-'temher'-was f42L Keep Nebraska.
ialiaa with the Ualoe. .-.
. .
.':H, W.'QinvaKTii. of Hnklredge, an,ex
.tbe twatmaat of aoU for. the
of BMMStare,aieadeav6riBg-to
have tha govarameat establish a etatioa
ia Nebraska whera hia methods can be
to the people.
Taa discovery of asix.f oot vein of coal
ia tha viciaity of Swedebarg hat caaaed.
sammaat thia week. The.
I partial feel- vary, jabttaat over
'thjiir gaod lack aaid everybody, is kopjiag
it ewill- prove a aaeeeas.-rWahoo
OsytAKOBuaaa.WJKBB, lefsihlioaa
far esaaiy ctera, m mamag a
of -the . eoaaty, aad
of- aaoees ' Thia -ia
a very greet oaai.waea it-iaeoa-
that hia.oppoasnt is tme of the
af poUtieal workera... .
: A. Jbsux will shortly begia
of oae of. the largest aad
ia Oamha, a hbaSe of
sajar thirty, rooma, the walls of atoae,
with tarreta.at.ths eoraers, praseatiag a.
.The iatsrior: wood and
wUlh
to be from Pat
hera'ia Iowa to
aiittrntairy
.Crowe sskathat all rewarda
ha wjthdrawa, apaa which
give hjaaaaK up for a fair trial.
tha letter is
sea-voJaateer la 18, his
amaaa
As far as ability ia
i every way aa wall
aa hia Ofnaiat. Give the
aid vote for Brod-
i iathe Uaiiad Stater the
Miitfi ftjli,ftli,Wr X
IHHI vHMPMI If t JL It IWPB I Ni g
. waUat
BsbbbbV fc H0
BflSHV - peee 3E
.MOHMiT.OCIOMIllkH: ' ' . .
iJil who !" .iag- Ueteeffaira.
.SsBBBBBBBBBWJWsBYm. .bbbb.bbbb. wsbbubb sbbbT THIi
Afl VH.W'HHV eaaBWBUBBi
- - " - W" . gJgJgmaMBI
SfHsSS!S9 bee
. iwiiw i-wjiii f biasa m do
flflVVBWMMHi BBFaweBmeaenB -Ba--a--aaa-a-a-.
'BBssaaaaaaavav
.
" aUydSafMwamfsaV. flBBsmVBBsal
with geed hopes
jj
, .
Ohiaf Daaahae,
taaaawr.MssdiaaapBhlMaa;.
m) aaaamt afatiatiraia Tagard. to lyach-
m'amaaaaarw at saaat'UUM ncraoaa.
slsfyiag alt law ami sathstity.
HSJS vHpwl amWaW iWiWat W mpTO JHIsaamsaS
M if f- . - "i-Y avrabfl.
Isyaa aaatral sat the eaasnnaaa which
LLIXi n iislsaasa. aai that isi
JET Urn aahaal asmaa Saw. 11, MM.
sooooooooooooexxx:
. Jftudon for the emoluments of office
only finds btit little fovor with the .honest
commoners who march with the rank and
file of the dem6p6p combine.Wymore
Wymbreani "";..-
JUST A feW-wo&ds. ;
an always appliea-
fiowerer renotetbey ay
horn tha ordinanr.'whaaever they
at. all cqaakfcred, tbetfccrk plaoea of
re briicataMd, aad the crooked
airaigkU':. .
Political foraat .aeTwnae.kifeher.thaii.
their aowea, the people, ..whence they
Bfboeed, aad wfaqae wiU they are aup-
toazDraaa. ".. . . .
auia. troabk. with oaf Bjfftem of
Mt.ia ia. the feeling, that one
of litilaaeooaat in the effort to
briaxaboat 6airab)e-reealta in poKtid
ac$aoa thk feUniteading to--indifference
aegtect, and .oiten to -diaaater.
whanaa the Irathia that'thft.aentiaienta 1
of .an individual are probably aKaredby,
a aa)Qorit7 of bie low-partkiiie, and
thairwU'coidiaadily'be made effective
by., certed effort. .
The history ot-partieew a conunnpua
iHaatratioa of .thia geoeril priBdple. ;
- Tai JouaJTAibelievekand in'tiuawe
think that rtpablicana generally are
creed. that there nerer has been a-more
critical time in. the bietory of the party
ia thip'state than the current auv
Jjaauay waya Nebraaka republicans
bare' recently' vinaicated ihemaelwe' tov
tjMMBaelvea;. -they' .have 'shown -their'
Strength' of. puraoae tor". have. the'righf
thiaga' done- at whatever aeeaiing.cost to
(he peraohalpride of. inidividual members
of the party or those in bflSciai position;
they have pretty 'effectually jjfiven certain
gentlemen of' the atatet'(tnat Jiaye for
!yeara been.asekirrg mainly their own
individual .preferment); to .understand
that servicesof this kiitd are not longer
tolerable. -To-tbe party, tb experience
has!- baeh Very trying; .'very expensive
aa'dvery nauseating.-... .
. : It.ia fihcarely hoped that ihe' better
day haa'faUycome;.'and that there will
fie 'no. -reaction- to. questionable fusion!
rbolitieaJor-td.mere machine, partysiml
a ". "
of any name.;
' '.. ? '. -:4S TQ &UOAR.. ''.''
.. As with alWeUc games, so Is it inborn
aieree, trade and politics, pot al'wkys the-
weight' of the MnteaUnts, but- their
sgiUtydecides' wnb comes out ahead.-
-.The aianafacturar of augar from the
sagarbeet'is.dneof the greaVindustriea
which baa been- thriving ini this-western
country, and it is jiatural' enough that,
is between two rival 'interests,' both
grasping in .thwr way, we" favor our owe;
.all othet;tbiag being, equal- -'..
Tae.:Paebla (Cokx- Chieftain' Bays:
The posttibn of the beet sugar manuf ac-
tntora. ia Teeurd to the attack upon their
VlMteThTthecaiMi snca'rtrnst,is riven
in a statement made by W. L.:Hartmata,1
attorney for-the -National Beet Sugar
Company, whose refinery and lands -are
at. Sugar- City, .Cola Both thia com-:
auuy's works and those of the American
Beet -Sagar Company at Rocky Ford
begaa the, annual sugar campaign last
week, sad ' lliey' are.' consuming -about
1,500 tens of beets a day. ' Mr, Hart man
saya -the -augar mills will be ran right
along the same aa if tae.American Sugar
Refining Compaayfe edict had not been
made,' but the coaipaniea will not -sell.
their product at; 3 cents- a pound, aa
the trust is attempting to force, tbem to
.da' Instead they, will atore it, if -necessary,
coaJdeat thuttbey will-not have' to
hold it king, but tlwirBeceaaaky, they
are able to-bold it until they get la living
price. A -eoniuiuatioo "of all the 'beet,
agar works. , "is .' intiaiated ' by .Mr
Hartaun.".'
-
- Pbbbidest McKrxLET'a.aasssBinstkm
aad -'Mr-Roosevelt's secession .to the
presidency are the.twd dominant topics
ia the October Review of Reviews. Aside,
from 'the editorial treatment of those
nHMseatous events, 'a, fully illustrated
'account of- the last daya'of . President
McKiatey Meontrffiuted-by Mr. Walter
Wellman, the aocompliahed-: newspaper.
eorraapoadeat, who "was himself' at
Buffalo aad writes from personal; first
hand knowledge of all the details of the
tragedy.. Mr. Wellman's comprehensive
article ii followed by a brief character
ization of this last of bur. great trio of
asartyr preaiaWts, from-the pan of Com-1
miatinarf H. B. F.MacfarlanJ, of the
Diatrict of Colambia';. there is also an
articWoa" President Booaevelt,.with por
traits of Mr. and Mrs. Roosevelt and the
mx Roosevelt children.- The Review pre
sents the full, text of Mr. McKinleyV
Baffalo speech, made on. the day. before
the' shooting, and "of Mr. Roosevelt's
address of September 2.
'Amobq Taraov items- in. .the' Humph
rey Leader we find thia; aad af it is good
democratic, authority., we take it for
axaated that it ia oae of' the living pic-
tares of the present eampaign for con
tfaaaaoa inomcial station: High low
jack.aad.abe gaaM,.-aearly a.fall hand of
eoaaty oalcera consisting of Walter
Phillips, J. Q. Becker, and hia deputy
Jerry Carrig, Was. O'Brien also C. J.
Carrig aad Denny Boberta arrived. on
the evening .pssseagar train. .Someriga
were ordered from Platte Center to take
them to the Jaworaki and Choaoa wed
ding. All-of them ware welcomed .and
pat oa tha Bearing floor. Every-
want aaaooth, exDaptiag. Carrig
BohBtts, occupied too mach
while dsaaiagwalu. Beeher.the
Ll ;... im. t'k. . m,
li mmtmammi mm aiiv mmbW)
i hole mi the ceiliag with -his
it .required two pumpkin pies to
it. The- boya reported a grand
' C..J. Ebbbt, the republican eaadidate
for regent, will receive a very heavy vote
k Taenla No aaaa' in that city ia
asere desarvedly popular. ..He baa been
repeatedly to run for oae pmce or
, but has aever had ambitions in
that hee. Hewfll be oae of the most
its ever elected. Hia
Geeld, ia alao very popular,
He ia a gantlsmia of
to, who haa alwaya. taken
at ia. uaiversity aaat-
Helms already made aa adaura-
Bearacerdaarageat.and itaaoald be a
to re else hiss to the
mate, Mr,
tan.
ixxxxxxxxxxxxxx
.
Wb
one.of thssmblams
with a view of call-
iag attaatioa to
taa fact of the hon
orable disshsrga
of George Brod-
faehrer from the mihtary aaryka of his
country against the report-to the. con
trary. We have aeen the original, a copy of
which- we print below. Tha dooassaat
apeaka for itself, aad iaodeataUy, let aa
remark that Mr. Brodfaekreria aow 25
years of age, active, able-bodied; level
headed, and will make a good- aheriff . of
Platte county.
. This is "his record as. one of tJncle
Samuel's soldiers; read it, votera of
Platte county, and 'decide for youraalvas
whether a aokberof the republic aball
e slandered with impunity':.
' TO AM. WHOM IT MAT C09CKK&.
'Know ye, That George F.Bfodfaehrer,
a private of Company K of the Fust
Regiment of Nebraaka Voluateers, who
.was enrolled .on the tenth -day of May,
one thonsandji eight hundred aadaiaety-eight,toaerve-two
yearaor daring the
war is hereby, discharged from tfie. ser
vice of the United States, by reason of
MUSTEK OUT OP BnGJXZKT.
No -objection to his' reenliataieBt- ia
known to exist. . ."
. The- said George F. Brodf uehrer was
born fn Columbna-'in the State of Ne
braska and when enrolled was 30 yaara
of age, 5 feet, 6. inches high, dark com
plexion, blue eyes, brown-hair, byoeeu
pation, a jeweler.
. Given at the Presidio, San Francisco,
CaU this twenty-third day. of . August,
1899. ' - . . William K. Hooks,
Cspt 1st Neb.; Inf. U.&Yola.Commaad-
tag the Uompany.
Countersigned C G. Mosrov, ' '
Capt. 6th U. 8. Inf. liastering Omoer.
,.. To be erased should' there be any
thing in the conduct or physical coadi
tion of the soldier rendering him unfit
for the army.
. XIUTART. BBOOKD. ". .
'. Noncommissioned, offteer. '.
" Distinguished service: nonel
'Battles; engagementa, akinnishes.x
peditions: Member' of .2nd expedition.
Was In 'the' engagementa before and
capture of Manila and various engage
ments of the Philippine Inaarrectioa
from Feb. 4th .until the 'capture of San
Frsncesoo Del Monte.
. Wounds received in servicer None.
Remarks: Services honest aad faithful.
William K. Mookk,
Captlst Neb. Inf. tJ. S. Yn Command-.
ing Company K.
r
. A 'telegram . from Tucson, Arizona,'
says tbat Charles -R.. and' Porter W.'
Fleming of that place have arrived from
the'.Galluro mountains, where they
report a remarkable gold disoorsty. The
I rich find is' located seventy miles north
of Tucson, end the vein of ore, according
to the Fleminga, w 200 feet wide aad
6JO0O feet. in. length. A canon cuts
through, the vein for 200 feet, exposing,
the ore on either aide the entire length
of- the cat. " It ia estimated the amouat
of gojd insight ia worth over $7tOOOjOOO.
The Tocsotf Star is authority for the
statement .that the story told by the
Fleming brothers is authentic and that
it has' verified the facta aa above given.
F.VKBT once in n while there iatalk in
Platte as well aa in other Nebraaka
conntics-of the organization of a tax-
I psyers, afisociation to make effective pro
test against extravagance in public
expenses; against the employment of
more help than is necessary; againat the
levy of mpre than is needed for the econ
omic administration of public functions,
against too long n cootinaance-in power
of men devoted to their own interest
mainly. "Whenever a man takes aa a
basis of calculation hia own taxes and
from that figures roughly the whole
ambuntof money collected for the entire
county, the -aum staggers him, and.be
wonders where all the money goes.
iT-'is aaid that the aoil of, London
seems to Have risen over Roman London
at the' rate of nearly a foot a ceatary.
There is, then, the present London; the
Roman London, and the earlier Loadoa
of the Britons. This ia not just exactly
a parallel to that portion of the current
county democratic ticket who are aakii
to be elected, for the third term, but
only n reminder of how hietory repaata
itself in different spheres. The' people
.of Platte county 'are "not spriagebiekeaa
in . the political coop" they have a
retentive, memory of two yeara ago aad
prior, and are making their calcalationa
accordingly.
Odb neighbor of the Telegram
to be catching it from all aides still for
what occurred to him at the late deaso
cratio State convention. Thk Jockhal,
although not fully adviaad ia the
iees, believes that Brother Howard
nearer the gospel truth on that
than were those who opposed hiat, aad
lit ia hardly fair in the York Times to
draw the scene than:
"Just ss Edgar Howard had' reached
the moat touching and eloquent period
pf -hia argument againat passes ia the
democratic State coaveatioa 'aosae
anarchist moved that 'editorial trane
nortation be incladed. The bullet
etrack Edgar in the abdomen and he
eellspeed..
Mas. Ema W. PxATTntof Chicago, one
of the women who haa helped to asake
Nebraaka famoae ia carreat bteratura,
delivered an address Wedaasdsy sveawg
at Wayne lo the State rederatioa of
Womaa's clubs. She ia ia ooaaidsrshle
demaad as "a lecturer Bad a writer of
abort atones. Her spans! baa of work
is aa book leviewer for
Tribuae. A gifted lady, her firat
iaeaea ia literature waa ssaBBemherof
the Ouaaha World-Herald
Jovkxax. looka to
and
Br the way, we do not rsmemhtr of
aaytkiag ia the publiahed reawrt
of the proceediagaof the lata damocratic
aad popabatstate coaveatioa ia
toeaUiagoa Porter to put that
back iato the atate treasury. How did
it happen Bro. Howard? ItasesMtethe
Leader that you let abp the OBaartaBsty
of your lifetime when yoa failed topre-
that
Wmuaii A. McAuJann, tlia rapah-
idMata lot aouatyjajslga,is wall
thronghoat' tha oaaaty as a
attonay, ia evaty way taaaV
to disohsrga tha
of om oT tha moat
tha eouaty. .A
aeaiaaUnrtiaasof old
Platta aad a varied erneriowba ia tha
practaoa of hie proJaaaJoa, hia alastioa
wOl besa hoaorto these who vote lor
For Taa Joaavf
writing my
priatediaTaBJoDBXALotOet.a,Iaad
that Captata Howard of tha Talagraai
has both aritieiaad aad coademaad tha
aame.- I.admU that he has a right to do
both, bat roiaim tha aame right to criU
eiee all wbo-aapira to oaaoaoa aay ticket
The good brother of the Talagraai would
have it that public critieiam ia "attackiag
paraoaally tha de.moaatio aomiaesa of
thia-eounty.n--
-Aa a- aiatter of fact whenever a asaa
aoespts'a nominatiou on say ticket he
tharaby.-iavitsa . the public to cxamiae
iato hia past reoord, sad it is. the datyof
the paWie to do aoad state the raaulta.
I thiak the great trouble with tha good
brother is that my obaarvationa told too
Buny'trathsto-Sufthim. Bat,"trathia
powerfal aad.'wilhprevaiLn
The priaeipal editoriala of the, Tala
graai, aad other papers' in the osanty,
consist .in overdone flattery of the aom
iaeea I have criticiaed. The good brother
jeevideatly.yoaEg.iB Platte oeuatypol-
itipa; although he. acta aa it he was the
whole puah of the'dsmocratic party here.
If he would tarn to the files of the Tele
gram aad also the Humphrey Damoorat
of August, September end October, 1807,
he wonhl lad "mighty .interejtia' read
ing," which, would certainly oauss him
to pauae'.and reflecU I 'should like to
have him pubUeh aome of the editoriala
of these papers; at that time,in'refereace
to' Messrs. Phillips.-'Byrnes and Robiaou.
The Telegram dare not do 'it; and will
not do it because that would not eait the
pressataitaation. .
Of course Brother Howard had. no.
connection with the Telegram. at that
tisoe, bat then and now the paper claim
ed to be a "reform", paper. What does
reform .mean?
Has the good brother observed the
oourae recently paraued by the arch
raforaaer of Nebraaka, ex-Senator Allen?.
For many yaara peat, vhile feathering.
hia own aest in Nebraska, be held ap to
public view the horrdra and craaltisa of
greedy, grinding corporations, and 'now,
lo and beheld, he abandona all hia past
palaver and becomes' the hireling of that
vaet railroad corporation known af the
Bock Island system. Aad for what par
pose? To beat aa honest, upright labor
iag man-Michael O'Neil, a titisea of
Columbua, out of what -he ia honestly
entitled, to. Mr. O'Neil lost both feet
while working for that corporation -as.
brakoman, through' the negligence of the
company in not properly, blocking the
apace between two raila at a awitching
pout. Mr. 0NeU seed for damages and
now the "great refonaet" is Working hard
aad fast : to deprive that aum from recov
ering damages! Shame on all auch
reformers! It' ia no wonder that many
sen who formerly voted the wreformn
ticket changed their votes nt the, last
election.
. As to the gentlemen criticised heretor
fore, Shakespeare's lines may be very
fittingly applied to their record aa'to
third term:
-O. CosefatMcy. thorn sit s 'J 1
The third term ia like Banquo'e -ghost
'in that "it will not down," and the "Im
mortal Bard" seems to have had an eye
oa Platte county politioa ia this year
1901, when be penned bin famoae lines.
Obskbvkk.
-'saaujaajnaswi
For the JOUBSAL.
BIBLK INCIDENT-DANIEL Hi. .
BT A.H.O. ,
Thtfm bmb soiuvl, at the Use's consumi
For their tskh in Ood, sad with
la the faraaee east, 'aid the mrenfokt hast
That coaaMed tha wda im iU Baauas abaat.
Fear awnlooasia tha atidstof the Are
WalUac aahanaed by its farrid ire.
Aadatxraatkiacaabdaadaadawad.
For tha f oaHb waa ia fana like the Boa of Ood.
MCoata forth, ja aarraate of Ood.
la the frishtaaad fctos'a appasliBs; cry. .
lad the three aajae forth, aaeeathad their attiie.
Oaly their boadacoaaaaMd by the are.
SerraaUof Ood.
boaad by pride,
est etiU be tried.
IaaalieUoB'a
Aad they atiU
with their faith aaacarrad.
Their
by the faraaee charred.
Often the eoora aad diadaia we aaaet
Test oar faith like the 1
Yatwa alwaya aad 'aaath the ehasteaiac rod.
Oae at oar aide like tha bob of Ood.
One of the bast records ia tha potato
rajaing line for thia, bssbob was aaade by
Aaderaoa Oieoa, who lives at 438 East
Ninth. From three city Iota which, he
had planted ia tabers Mr.CHeaon har
vested a wop which brought him $170 in
eurreat coia of the realm. Fremont
Tribuae. . T
A school without aiagiag ia like a
day without the eua, aad the teacher
who dose aot have the pupOa abig is
missfag aot oaly a heipfal aid toward
theeoatrolof the aohooLpbat iadepriv
iagcaildraarof aa uaportaat aleaaaat of
trainiag at a tiaaa wheii they are the
swat susceptible to-its iafiaence.-Pror.
Hewitt in BaU wood Oaaette.
Thoa. Ottia aad daaghtar, Mrs. Cob
doa,kA Tuesday for St. Paul, Mian, to
..Joe Korth
uvtag five miles east of Liedaay aold hia
at weak nnaaistiag of oae-half
toFrehar k Prieaater ef Coatm-
fliOOa Mr. Korth
templateato
ia
the fatam-Hampkrey Leader.
W. J.OBrisa, aaperiateadaat of the
atate fah hatcheries, writes Car, Sehav
laadtaeiaaapplyofbaaawillUaaaito Madtaoa Friday, October 18th for the
arill pond. Ia the eoaraa of aaveral
will be the order of
factory at
itafatti
the pleat at ita fall
a day. This year the
at Greed Island will he shipped to Kor-
felk to be bm
1 itaffiraal I tfaL I
In aaamaia aad arast woaaaa ail-
ta the digestion ia weak, tha mskiag
af color, lash sad atreagth oat of food,
o that tha pataeat ia weak
and dyspeptic. This cob-'
sStioa caa be oortaatsd by tsJoag a
aoaraa of HSRBINE. Price 50
A-HaiatxaadPoUeckarCc, .
' Probably the largest local shipmeat
ofitakmdmthewaatwaareceivadhare
Wsia isdsy :aseraiag by. Was. BloadorB.
It eoaaawed of tea thoaaaad poaads of
oraehsd oyatar ahella. Taiabaeiaeas
has growB from abipping oae'huadred
at a tiaaa to the praaaat large.
It is assd for chioksa food.
Platte Geater SigaaL
Joha Ramng, aoa of' Pater Bamag,
Uving aear SBeraard, died last Mon
day eveaiag'ot typhoid fever, after aa
iUasaa of oaly a few days. Tnis 'is aa
extraaaalyjBajd affair. The deceased waa
96 yaara of age; jaat in the prime of life,
sad he waa a young maa'highly respect
ad by all' hia acquaiatancea. He waa. a
member of the Modern Woodmen- and
Woodmen of the World of thia place.
The funeral waa bald at the SU Bernard
Cathelic chareh Wednesday afternoon,
quite '4- Bamber attending, from. here.
Hamphrey Democrat -
'Jtioob Sturmer, about fourteen yeara
old, waa brought ia here 'Saturday from
Dunoaa, along with -three other boya
named Binder, Nowitaki apd Coloha,
aged nine to "twelve 'years, the three
tetter being taken' to the-hospital, the
Bret earned placed with tha aheriff under
the charge of' ahooting the others. ' It
was thought at firat that 'one of. the
injured boye might lose the-sight of one
eye, but later it seems there will be no
serious injury. A partial hearing waa
had Monday before County Judge Robi
aon, which waa adjourned to this' Tues
day afternoon. Young Sturmer claims
that on Friday he had been out hunting;
had only two ahella, 'and had fired them,
while hunting. Coming home, the boya
called him names, and 'he snspped.the
gun on tnemexpeoting to. frighten them
didn't believe it waa loaded. ..
The recent hard rains hate thor
oughly aoaked up the ground to an
unknown depth and assure "a crop for
next year, for it was demonstrated thia
year that the thorough soaking that the
ground received last 'fall was whit made
the crop this year .....Sheriff Patterson
panned through here last Tuesday with
John P. Nobnan.in charge. The latter,
waa arrested for 'perjury and, unless- he
is able to'give the required bond, will be
put in jail to awai$ trial. It appears
that Nocnan, "after failing in a suit 'for
I divorce' from hia wife in his own (Greeley)
county, went before the Boone .county
court and there swore that he. was a
citizen of Boone county. It is hard to
anderatand how a man in hia'right mind
could be guilty of such a strange act
but he did thia very thing and conse
quently haa every serious trouble on hia
hands. Cedar Rapids Outlook. '
D. H. Young of. Lincoln was in the
city over Sunday, the guest of his friends
the Jottbhai. editoce family, -He had
been on a trip to Antelope' county, and
had evidently enjoyed the ride across
the country, behind his handsome little
ponies. He is'jone of the old-fashioned,
down-east gentlemen, and as full of
remiaiBBBBflca of the anti-slavery times
aad campaigns' aa an egg is of -meat
Having been n business man of Maaa
chaaette when Daniel Webster was there
considered the greatest man that ever
lived, he could tell us very interesting
incidents in the home life of the great
orator, ao that in imagination you could
almost see the faaaoae statesman, aa he
enjoyed himself on. hie farm at Mat-shield.
Mr. Toung has a vivid recollection
of the exciting times when authorities
tried to enforce the fugitive-alave law in
the cities of the east. He later, went
aoath during the War of the Rebellion:
aad afterwards, - ao that to hear him
relate his experiences by the way, is
much 'mora interesting than to 'read
auch things oat of a book.
Cs!ava(,(.ssvsv
' ierNl SeiitiaTir.
:: tkmtm
L Gluck waa in Omaha last.week.'
Mrs. Bev. Butler of Monroe wat
in
town Monday.
Will Schram" spent Snnday at home
with relstives.
Mrs, E. Pohl made a visit to Fremont
1 frisn'da Thursday.
Mr. Braokley of Schuyler vhuted
frieada in the city Sunday.
Mr. and Mrs. E..O. Brown of Hum
phrey apent Sunday in the city.' '
Mm Bey Martyn of Humphrey came
down Wednesday last for a visit.
Mr. and. Mrs. Carl Johnson of Bell
wood visited friends here test week.
Miss Lore Becker went to Bell wood,
yesterday morning to visit Mrs. Gould.
Mm. AL Schram went' toTopeka, Kan.,
Moaday to. viait her sister a few weeks.'
.Miae TJraoe Clark came down Friday
from Pierce to apend a week's vacation.
Mr. aad Mrs. Hanson of Fullerton are
visitiag Mrs. Hanson's father, Mr. Miller.
"
J. E. North returned Friday evening
tram a trip to Minnesota.' Heconaidera
that a great country. . .
Mrs. F. W. Herriok is expected home
Saturday from bar summer visit -to bar.
old home in New York. .. "
Mm. Katharlae Fraas, mother of Mm.
M. Bebraat, atarted Monday. forHlinoia,
will vaatr for aome time.
Caha Maddea 'retained .to her
ia -Omaha Monday 'after several
1 viait. with her sister. Mrs. A. J.
Smith.
Mr. aad Mm. B. F. Chambers returned
Satarday to Niobrara, after a two
viait here with' their son, E. Bv
Eva Sullivan of Harvard. lit.
who has bene naitiag relatives here sev
eral weeks, want to Albion Satarday to
visitfrieeds. .
Mas. J. H Sturgeoa weet to North
Platte today (Tuesday), where she will
visit her daughter, Mies Lydia. She
will alao- That bl Gotbeaberg before
Mam Aaaa Kinase retaraed Tharaday
r Colambaa, Ohio, where she
the past two moaths with aa
oa accouat of
sMwaaamaaaaVMBaBa
I I. MSS mMHIMIM. I
K taval IwffTw fsTVwwanaTfJajWf7aamjmBmja mm
LAXB Or TUB
llaTstal CsaatnsaWT af MC,
Teacher of
PlANOv V1CE CtlLTUBg,
' eeif,. akt or stmum.
1
JC Jsjs9aa wa 0aUa"g V4vsjSaaamwBm 4wsWJU
WiaUr lemliaa; aa thf lam.
Loaaf.eveaiaga are hare agaia aad aat
urally one thiaka of a good faaaily agri
oultaral weekly, becauee ita ragubir visits
are welcomed by the whok).f aauly.
. The Tweatieth Century Fanaar.ia oat
of the rat ia which Boost agricultural
papera travel.' This is tree particularly
of theepleadid illastrationa-from paoto
grapha taken by their own artists aad.
special articles by the beat' known aad
aioat practicaTaMn ia every breach of
agriculture, each aa N.-J. Harria, aecre
tary of .the Iowa Seed Cern.Breedera
association; H. W:Campbell; the author
ity oa edil-culture; 'Jaaaea.Atklneon of
the Iowa experiment station at Amea,
la.; Frank G. Carnenter,fsmona'for hie
letteraof travel; C;R. Thomas, secretary
American Hereford BreedeTsaaaocia
tioa; B." O. -Jowan; assistant . secretary .
American Shorthorn Breedera assoeav
tioa;Dr. A. T. Patera, Nebraaka jsxpsrf-
meat etatioa; E. F.Steohenr, pieaidaat
Nebraska .Horticul thral aocietyt Wo-,
man'a Department, condueted by Mrs.'-
Nellie Hawks, Friend, Neb. J.J.Edgsr?
ton of the Iowa Experinjent Station, arill
answer, all questions relating., to 'live
stock matters. ..". ,..-
' This is a weekly 'agricultural, family
pSpfr, in whieh' the farmer'a wife is par
ticularly interested on account -of the
'pages devoted to her particular intofests.-
Ip fact,, there' ia bo .paper, publiahed
either in the east or west ihat meets so.
well the- wants of the "western; farmera
and attek raisers.and .their families:
,. If you do.not get'it'een'd'10' cento fori
ten weeks trial subscription to -The
Twentieth Century Fsrmer,1896 Faraam
etreef, Omaha, Nelx, and, you will have
an .opportunity to.' become'-acquainted
with it A dollar will bring itibr a' whole
. " - .. ' A.
year. . .
'. r """ .
. Xsal Ikate Traewfart.'-
Becher, Hockenberger. k Chambers,
real estate' agen.ta, report the followiag
real estate transfers filed in the oaaoe'of
the county clerk since our lsst report:
W K Lay to EluM Stevenson,' .' "
lots 5. and 6 bL8 Smith's add ' . . '
' to Columbus, wd.; . . .-. Si .'. '. .-S.lfSOO 00.
Sullivan k Reader to John' Stor- ;' -: -,
itz, e2 ne4 4-19-le; wd. I ... . .;. .2880 00
Julius J Grives to-Fred FsngU "-..
gannt s2 nei, pf se nw" 24'
". 10-w, wd. ...... ... T. ....". .. 1080S 00
PE'McKiiiip to Henry Lem-'. -
-. ' mer, pt lot 10 bl 7Lindaay,wd ' ." 25 00
-Hope Cemetery Asan to Hattle .
;' A Tabor; lot 158, Hope Ceme- '."
tery'in ne4 284w, wd...... .. -. -10 00!
Kotfeer Town Site Co to John - ' .' -
Wagner, lot 17bl 8 Creston.wd '. 100 00
Union Pacific R RCbto J.'H
Carjson, lot 2isec 19-l7-lw,wd ' 59 37
F B Eimers. to H F Brodfueh-"'- ". .
rer, lot 6 bl 15, Becher Place -' -
add to Columbua, 'wd. ..:... ' 550.00
John Ernst to George Iwan,'pt-
se4ilC-2w,'wd....... ':.-..... -.' 40 00
George- E Stiles- to" Frank G .
Hollen'back, lot 3 blc29-Ste--'
vena add to Columbus; qcd.. . ' 1 00
Total ; .'.". ..-.....!. . .. . tlOKO 37
Cuiaf
- .
'We 'deatre to express our thaaka to
the friends who 'so kindly-'gave' their
assistance during the sickness and after
the death of our dear baby. 1...
Ma. and Mas. WJ-W. Binxcav
CTtelce Irssl Siertaeras.
Eighteen bulk.-for sale.. I .want yoa
to aee them, Whether Jroa wish to bay or
dot.-- -It will do you 'good, to look at
them. They-ajre for.aale at prices guar'
antoed.to.be aa low aa in .Iowa, atretail.
tf '.'"' "C.K.DAVTBB.'
You can 'bay blank farm leases st
Thb JouBKAbofBce, good form; iwb for
5'oenta; fivefor-lOcenta-For
Superintendent of .Schools,
COLUMBUS MARKET9.
Wheat, old' ...........
-nAvr
aev aw
55
Corn, sheUed-rV buahel'..'. ' JK0'. ''
Oats, tt bushel . .. : .'vf.v. '. 32 . r
Bye .y bushel, ". . . .-. ',43 .
Hogs cwt.;.:..".....'..j5 60 5.80
Pat cat tie-Wcwt: .... .... 3 90 60
Potatoes-? bushel. '. '.:. . 90 1 00
Butter W -1. ..:. 1' ..-.. . ;. 15j .
Eggs V dokeni ......"...". 15
Marketa corrected, every Tuesday af
ternoon.' VJtPOrtT OF THB CPJlblTlOM.
pr-TBB-
Ciliilis Staff Bmk,
Charter Mo. .,
At Columbus, t'ft the State of- Nebraaka,
.at the clone of bunne; -"
' ' September 30, mi: .' .-;-
axsecacKB.' . .
Iiaaa aad diaeoaata ".... ..-b12Lb71 77
OTerdrafU,'aeeared aad Baaecared... f.4M 21
atocha. accariUcc. jadsiaeata. claiaw, '
eataa i 9 aaa 94
BaaJdashoaaafarBitareaadaztares. eJBa
VJUMt IBbU 6ICII6. mXMflBm m$
Cajrreat m nan aad. taxea paid ...-. ' S.4I4 8I
CheetoaadotheroMhiteaw :..:. XmH
DoefroaiNatioaai.iJtateaadPriTato TJ
Baaks aad Baakera:.... '...-.'. ........ fcMuS.eV
OaahCarreary -.......! XM90B
uAgOaBa CasaSa a aSlp4 ay aw
rJUnrdollara.. ..'-... t... ..,..: 48BS9.
Fractional ailier...' ...-. SKOS . .-
Total cash on hand .,.. M,13Se9
Total....,
............ .. ..
.V&smm
UABIUTUn.
Capital atock paid"-ia...' .. SBLflSBM
DsaaPaawM IHsbOo -eeaaaF amy
UaMMAaJ nmSta - N Bat IS
BBaaBbl JSaBTJU VIVBttB.,1 , t . Pb
ladmdaal dapaaka aabject
toeSek- .-.-.... auat.se- -
Fnaiasl caatiBcatee of de..' .
WMjBBB BWWBj Aw
Tfaeeertiacataa of deposit WtftW SS
DwatoMatioaalBaaka..... 8NMt. .
TJae to Htate aad Private '
.... av -I-.SVM a
of 'the aboTcaaned
of ray fcaowloi
that taeaMer
. M.BBCOOB8.
rAtteat:1
Teaaaaa Obbbabd, Director.
Oabbbxt Hcibt. Director. '
flsiiuMiil and ewera to before aw this tm
Bsbbb sad naaxcra.
Coaatyof
bealcdo anlnaialTaaiai
awat Ia.traetothe beat
belief.
day.of Ostohar. ISM.
Fremont - Normal - School
and Commercial Institute,
CfJBSEB OF STUaT.
18
18818.:'
-
TaeacsMolftartWamaasa. Noeaamiaetieaeaeatry. Caa eater at
any taa Teat, baake raated. la taia item we save oar rtadeata
to pay ear tare;
OFFICIALLY BEOQNIZEa.
:
... OanisauaOtats
niBIACI C01T18E.
The heat and aaaat esmshtaie the wast; State
s-aaaeh Ms thaa w other seheola. Stadeato-sBaV
. ., eatire
-
or take ether work
COHHEITCIAL COUBSE.- -
" Thorough, Brajstieal aad up-to-date. ActaaT
SHOBTaf ANB ANB tTFEWBlTlNfi.
. "Na eehool I btera sqaal advantagaa: . A atx inoetae scboUrseip for
. .. taaOO, aad if we havenot secured a nositioa, yoa caa stay oae sabatav
loagar free of charge.'- -:
'. ..:-":.'..- - -.- . -'
II8K 01TBSE.
.-.. -'-.. "-"...----.-.
' '''.Piaao,0aBB,Violja,a1aBdoli -- -
mm- W. H. CLEMMONS,
SEND FOR CATALOGUE: .
. . .-
PROBATE NOTICE. .
la' the raaatt eoait ef. Platte caaate. NthraJaa.
lalae aastteref thf aetata oCJbfca aawher.
- iltPiaaiit. Netiea et Baal -aattleaMaC sac!.
. To-the eraaXtoN. hetia. lam'tin aad athere
taHfialiJ U the eataMeff Jeha Baaher. deeeaaad.
Take aotiee that WilBaai Bartier harilad igthe
roaaqreean a-iapottof utaa
trator of the eatata of John 1
aad it iaotdend that .the aaaie ataadrfor
iaceathelatdajrof katiihir.MSl.hafa
epaK at tha hoar of t o'clock . aa...ar- whieh
uaw aayainoa larwaaiea aaw awear aaa-ea-
coot Maadcoataat tha
thieaotieoie ordered siaaitB Taa CoLBSBea
JoeaaAL forthraefnainattTewoika.arier to
ttofatday.ef
Witawai
WitBeaa ma head aad tha aear off the coaari
oajei neveawer. mm.
raaad aad
ilaaihaa Ufla
roartat Colaahaa
una nur oa of uatoaar.Met.
f-ljSoatr
T.D.
Mtsoa..
CeaatyJadse.
PROBATE NOnCE.'
la the aaUtar of the eatata of JohaaaH.-.HeU-
baaaldeefoaed. Motkotaeradkore.
' Metiee ia hereby atoaav that theTreditpre-of
aid deaaaaad vuTTaelat tha edmteMier
wttsj wiU aaaaxed of aaid aetata; haferr aav
Coaatjf Jada of Platte coaatx. Kthtsasa. at
jay osVe.ia Cbhuahaa. aaid eoaatr. oa the'
Uth dayolr Netaathar. JBM; oafheAh dor of
Fehraair.- MB, aad-oa the- IMh day of May.'
uac.s z oeieea p. au. oi aaea aay. for tae
oz pnaeanac uatr cMuaa tor
mix BMasha.ara allowed ton the craditore to
preeeat their cleiaai and aaa year far tha
ietiater withviH aaaeaed to eel
xraatfhelMh
her. MBL, aad ttua
m-THB Counaes
aotiee ia
Jouax
otmaAi. far
arior to
the Uth
IsaiL
Moct4
PROBATE NOTICE,
la U eoaaty coiitof Platta'coaaty. Winiaaks:
Ia the BMtterof the estate of. if a Heary laa-
'si n. aeeiaaeit. . Notice of aaal
aailannnast
' T.i the riinHtnra haUa. leaataaS
lunaceatateor joaa jieary
Take aotiee that H. I.
it ia ordered that the
for hearias 6a the Mth day of October. Bat, he
fore the coatt at ihe hoar of 2 o'clock aw sl. at
which tiaw aay peraoa iateraeted aMwappaar
aad except to aad eoateet tha Mate. .
Thia aotiee ie ordered ajwa) ia Tan Coufsaea
JovmntAU for three eoaaecative wet he prior, to
the BXh day of October. MBL
WBaseeiay head aad the aaal of tU
coart at Ctaaaiaae. thia aithday of ne
IBM.
ISBiU.1
T,p.
?ectJ"
UToaatyJ
. e. casin,
raoraiBfoa or tsb.
SaltMeate-
flatrin iktifl Wfi in SeJttlL
.BBBj BBBBBBBBBWgJ aBBBBBByaBBJ BBB BBBBBBBBJv BBBBBBJ BBB'WpajBWfBVWfajBBBB)
- a . 1
-fBigkeet aaarket pricee': paid tec
Hidea'aad Tallowl - 1 . . . . ' -.-
... . - -.. - .;...'.,- -.-
'" - ttvlTEI:rT fT.,. ' I
- - :. . : -. ""-. '-.- :
COLUMBUS, - - NEBRAaOA
D. BTiBBJ.
OMka; Oli-e .Bt. ap-etaire la firat Hetieaal
.- '" BBajkMd'a ... ."."'
y-y - Coiearask. -MBaaAasa. : .--.-
BwJblb ihitd Btmrm
- " frqm,qm4ha;v.;
.-,-'':-jhK7'?.
TWENiyrDAt: TICKET . . .
$33XK). V.:: -
a T a a "
TOURIST'S TICKET, KK)1 UNTHj
.-qoT,-n; " -..-
CLEVEIVAND aad RETURN. HEFT;
. jwa ie.iaB, -
. - .- - -'. . -. '.- .-- -..
GXX)D UNTIL OCT: 8th; '. :
Write aad get fuU ialbrjsatioB. -.
..:. F.A.NASHVO.W.A; "'.
15 Faraam StO-aahi.
h: w: howelx, t.-p. p. a. .
WAKTiTJ-8TllUL reatJONH Of CMAM-
llto
lereoaa
r wBK
au-BBsaaie-aB
tie aaid
T.O.aVawBoa.:
CaaatyJadaa.
tjiaaaiBnma.eatataor joaa jiaary maBBaaeaa.
rsssiaiiahaaBladie
the eoaaty eoart a report of JUa rtniasa aa eaeea
tor .of tha -aetata of -Jeha -Heary aaaaeaeia
Wlfot Mwt Maialt
CHEAP RATES !
- . .
- uPBiyN.' ;::::';
IMlWALVLTEt v
M' Ja aw m m
... Mmt v.;;.
SiJaaL. - m
-Ba3aatf BT
aBSsBa.BF uaasaT -
fW S?1 J? iwg Sfyffi I
work. Noaahooloffefa
reeoaauiad the aahooL Jalv 15.1901.
good tor 2 years; 3 years aad life. -
iacoaaeetiba without extra
the aatireyt
. ....- -
Pfwtlain4
TTTyTF: TABLE,
COLUMBUA NEB.
Chicago;
'-attei-i-' -:.
BMlcUhCltyU'
Peatiaasl. -
Jai-;'
aaal:- all
TBAiaa sOabt. -.
daU-axcrJaaday. ?:IVa.
a; dally azcept -
No. 21
vdaily except aaaday. 9HOpim
Ne.H
wuij aaaviw
;-o ............ ...,-.t. ,isv pai-'
----
TIME TABIE TJ,1P.:I. R, .-. --
.BArtaoeaBuMAinuBk. :
Ho. 8.1 Cnlaaihaa LbctJ lV -.-- . sat ..
Mo
Me.
Mo
' "? . Mau...;.. ...,-. ..-..:.-jl p, at:
mSr' fJIfc.aayet-..-.:J-.-...2:l p..
a .-
N::atgrSn.
MeZVraiBht..
Me
" yiniiiii-.....'....;-.. a:itp
'.'. SiHr. ib m r"
AALt- Im. .-
ar-.Wp. at;.-
aH-Jeeemh,-.. -. ,
yaasssCttyt; -.
aaVawJa aaal air
lKBjbtta'alaat'aaisV
aVmta.,:.
flB
WBST aoCB MAIN IBB. ' '. . ..'.--.
S.JP"----.-v--..-:...wn!a':Bi. - '.?:
Mo: J. HteiaeKxpreaa .V. .-.... e p. an.'-
S' K&g'as-ail....;......,.. iaa, ai: '-- '..
K---2'.5S5k,",e,,,.'-"-: .- an.aa. .-,-
Ha..Wmd.......::..:x.-.:r.::. SrSaamil.-iV. ,
"r Momroikr BBAjKn:-.- - ;. : -. - - V '
71; .Mixed- ,..:.:.,. ;:.. ..MSa.au: - .,-.:..-
" - ' .- ". . - -. ; Arrit'e- ."-- - '
2'S" gnaar...:. .....'.., .-.;-;rlaap. .:;:.- -.
M0..72, Mixed' :,.:. :.:,,. .:.:..;... JSp-. m. .-.. '.-,
.".. .aioM ABeasBAB-BAnBaaaAifen;- .''':'V'...;'
fe5S5
- -. - "- - w .- . - -
mBBBBJBBV,--! i W-l
itf .. 2lU . MBC. r- -J
o.'.".v.i Ml. ait. " ;
- '4 aaa t " . " "
ao. w. raaaaoar 1 --?...
e-"r Buxaa. ,..-....j..'...i .-.., -. IMS p. at.,
1-JloUaiaeoaAjlloa aadt'edar Kap..afaadl'
Cnlaaihaa Local daily '-xcept aaday, ..
"-'. ..( awjrBABvAsaat. '
Blicksiith ail
III
.--.-."'
, . Efirjtliii ;iaiaii:' liiV
Me.Trt7tftiMgfsran
. C Wirwbs BBaee f rigrK
;:iet'4grrs)riB:-
:V?x-;;V :S"-""J
i ? J'W-"-Wigiv3iii
am ageat for the eW reliable,-...
Colambaa ..Baggy Cc-wpaay, of Colai: V'
dw, vuo, waieauT a SBBBejeac guaraa-f :.
tee of stiyirBtcU-e goods:-:;; 1- '''
LCMJI5 SCHftEIBErt
-ja-octtf.
. v- :V
i . - -'-
!-"
B
8T SKVI,; :
npi. jraWVBaraiaVi'Xa. :s
adTOlT-8.v:.-i?-I
EST T-IACM-, -' --
ESTKOUTE "V, 5
..-'-.-.-. :--X
JO
- "TayeTssTf wawsrs9wa
AsBaSaBkBaafBBBB
WmmwwkwmmWkm9 evaWJ a
AN rwia. Entsi CMat, I
" .' ' "' " via iblE
f ChlCe
.LMww-
.deati'aed.fQr-'
it cities east of the
iri -River ehoakf pat-.'
reniaethmrputei-..-:.
- .-' ." "- '.-.' --.'- " -.
TW through tralaa are Sal-'
idly VeatibaJed, elegeeUy
.eewiaaed with Doable
lwfaRoom.Md.PBiaee
a la Carte; 'Free Raahauag
Chair Cars. "- :"--
-Fortieheta
- call ob :.
1 full iafonaatioa
tf'
WbL'Jbbtbjm. Agaat,-"""
ATTOatKEYS AT LAW,
aVaeaB kVarlr
. i
I.BVerfBBe aBBBBmeawyssBBTSsBTaW
A
r-
..
r-
.--.
-. ,-;- -.
-J
. . -. .-
L-.
. .- .
- t -
- .-
? -
".
i
1
... t
" . -'o
- .-':
" "-
'Pscterpatit
'v..
- -.'TOs .
ssan.sj
MiLbtfSssmdii
rfB.
,-- ZJL-.iLJ'!i';':'' jL&JtLf."-. SSki.
C-J.V -L X -" -Vr -J.r